Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Contenders 100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 78 pts. 9,993
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,964
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,947
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,936
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 9,936
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,804
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,788
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 9,694
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,596

  1. Avatar for DoctorSockrates 71. DoctorSockrates Lv 1 8 pts. 9,396
  2. Avatar for weitzen 72. weitzen Lv 1 8 pts. 9,357
  3. Avatar for Merf 73. Merf Lv 1 7 pts. 9,330
  4. Avatar for Superphosphate 74. Superphosphate Lv 1 7 pts. 9,327
  5. Avatar for spritz1992 75. spritz1992 Lv 1 7 pts. 9,323
  6. Avatar for alcor29 76. alcor29 Lv 1 6 pts. 9,316
  7. Avatar for dbuske 77. dbuske Lv 1 6 pts. 9,292
  8. Avatar for carsonfb 78. carsonfb Lv 1 6 pts. 9,272
  9. Avatar for ProHarTius 79. ProHarTius Lv 1 5 pts. 9,269
  10. Avatar for tokens 80. tokens Lv 1 5 pts. 9,258

Comments