Placeholder image of a protein
Icon representing a puzzle

1406: Revisiting Puzzle 134: Rice

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 20, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Contenders 100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 78 pts. 9,993
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 9,964
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 9,947
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 33 pts. 9,936
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 9,936
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,804
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,788
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 9,694
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,596

  1. Avatar for pfirth 81. pfirth Lv 1 5 pts. 9,222
  2. Avatar for bcre8tvv 82. bcre8tvv Lv 1 5 pts. 9,197
  3. Avatar for dssb 83. dssb Lv 1 5 pts. 9,197
  4. Avatar for Mr_Jolty 84. Mr_Jolty Lv 1 4 pts. 9,171
  5. Avatar for Hiro Protagonist 85. Hiro Protagonist Lv 1 4 pts. 9,140
  6. Avatar for Mike Cassidy 86. Mike Cassidy Lv 1 4 pts. 9,118
  7. Avatar for dizzywings 87. dizzywings Lv 1 4 pts. 9,115
  8. Avatar for tomespen 88. tomespen Lv 1 4 pts. 9,113
  9. Avatar for fpc 89. fpc Lv 1 3 pts. 9,041
  10. Avatar for Neil9 90. Neil9 Lv 1 3 pts. 9,004

Comments