Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,606
  2. Avatar for Kotocycle 12. Kotocycle 2 pts. 8,583
  3. Avatar for Russian team 13. Russian team 1 pt. 8,572
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,501
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,453
  6. Avatar for xkcd 16. xkcd 1 pt. 8,429
  7. Avatar for :) 17. :) 1 pt. 7,865
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 7,317
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 6,804
  10. Avatar for BOINC@Poland 20. BOINC@Poland 1 pt. 5,999
  1. Avatar for Czuppy 91. Czuppy Lv 1 2 pts. 8,469
  2. Avatar for spritz1992 92. spritz1992 Lv 1 2 pts. 8,466
  3. Avatar for SaraL 93. SaraL Lv 1 1 pt. 8,462
  4. Avatar for harvardman 94. harvardman Lv 1 1 pt. 8,460
  5. Avatar for Merf 95. Merf Lv 1 1 pt. 8,458
  6. Avatar for Mr_Jolty 96. Mr_Jolty Lv 1 1 pt. 8,453
  7. Avatar for Iron pet 97. Iron pet Lv 1 1 pt. 8,444
  8. Avatar for pfirth 98. pfirth Lv 1 1 pt. 8,433
  9. Avatar for fryguy 99. fryguy Lv 1 1 pt. 8,429
  10. Avatar for FishKAA 100. FishKAA Lv 1 1 pt. 8,423

Comments