Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,606
  2. Avatar for Kotocycle 12. Kotocycle 2 pts. 8,583
  3. Avatar for Russian team 13. Russian team 1 pt. 8,572
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,501
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,453
  6. Avatar for xkcd 16. xkcd 1 pt. 8,429
  7. Avatar for :) 17. :) 1 pt. 7,865
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 7,317
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 6,804
  10. Avatar for BOINC@Poland 20. BOINC@Poland 1 pt. 5,999
  1. Avatar for rtkitters 101. rtkitters Lv 1 1 pt. 8,408
  2. Avatar for jermainiac 102. jermainiac Lv 1 1 pt. 8,397
  3. Avatar for Mydogisa Toelicker 103. Mydogisa Toelicker Lv 1 1 pt. 8,380
  4. Avatar for jebbiek 104. jebbiek Lv 1 1 pt. 8,376
  5. Avatar for Arne Heessels 105. Arne Heessels Lv 1 1 pt. 8,364
  6. Avatar for tarimo 106. tarimo Lv 1 1 pt. 8,364
  7. Avatar for Vincera 107. Vincera Lv 1 1 pt. 8,350
  8. Avatar for Fog Darts 108. Fog Darts Lv 1 1 pt. 8,321
  9. Avatar for Superphosphate 109. Superphosphate Lv 1 1 pt. 8,290
  10. Avatar for nemesis21 110. nemesis21 Lv 1 1 pt. 8,284

Comments