Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,606
  2. Avatar for Kotocycle 12. Kotocycle 2 pts. 8,583
  3. Avatar for Russian team 13. Russian team 1 pt. 8,572
  4. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,453
  5. Avatar for xkcd 16. xkcd 1 pt. 8,429
  6. Avatar for :) 17. :) 1 pt. 7,865
  7. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 7,317
  8. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 6,804
  9. Avatar for BOINC@Poland 20. BOINC@Poland 1 pt. 5,999

  1. Avatar for rinze 111. rinze Lv 1 1 pt. 8,257
  2. Avatar for Anton Trikshev 112. Anton Trikshev Lv 1 1 pt. 8,238
  3. Avatar for tokens 113. tokens Lv 1 1 pt. 8,214
  4. Avatar for DScott 114. DScott Lv 1 1 pt. 8,151
  5. Avatar for momadoc 115. momadoc Lv 1 1 pt. 8,130
  6. Avatar for khendarg 116. khendarg Lv 1 1 pt. 8,112
  7. Avatar for ProHarTius 117. ProHarTius Lv 1 1 pt. 8,111
  8. Avatar for fujioyama 118. fujioyama Lv 1 1 pt. 8,103
  9. Avatar for poiuyqwert 119. poiuyqwert Lv 1 1 pt. 8,101
  10. Avatar for Pibeagles 120. Pibeagles Lv 1 1 pt. 8,057

Comments