Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,606
  2. Avatar for Kotocycle 12. Kotocycle 2 pts. 8,583
  3. Avatar for Russian team 13. Russian team 1 pt. 8,572
  4. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,453
  5. Avatar for xkcd 16. xkcd 1 pt. 8,429
  6. Avatar for :) 17. :) 1 pt. 7,865
  7. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 7,317
  8. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 6,804
  9. Avatar for BOINC@Poland 20. BOINC@Poland 1 pt. 5,999

  1. Avatar for Palenta 131. Palenta Lv 1 1 pt. 7,704
  2. Avatar for martinf 132. martinf Lv 1 1 pt. 7,641
  3. Avatar for Deleted player 133. Deleted player pts. 7,635
  4. Avatar for tamanrasset 134. tamanrasset Lv 1 1 pt. 7,573
  5. Avatar for NotJim99 135. NotJim99 Lv 1 1 pt. 7,514
  6. Avatar for lamoille 136. lamoille Lv 1 1 pt. 7,464
  7. Avatar for Sitizyn 137. Sitizyn Lv 1 1 pt. 7,432
  8. Avatar for luoyan 138. luoyan Lv 1 1 pt. 7,372
  9. Avatar for smittie2000 139. smittie2000 Lv 1 1 pt. 7,361
  10. Avatar for molleke 140. molleke Lv 1 1 pt. 7,317

Comments