Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,606
  2. Avatar for Kotocycle 12. Kotocycle 2 pts. 8,583
  3. Avatar for Russian team 13. Russian team 1 pt. 8,572
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,501
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,453
  6. Avatar for xkcd 16. xkcd 1 pt. 8,429
  7. Avatar for :) 17. :) 1 pt. 7,865
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 7,317
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 6,804
  10. Avatar for BOINC@Poland 20. BOINC@Poland 1 pt. 5,999
  1. Avatar for reefyrob 11. reefyrob Lv 1 72 pts. 8,874
  2. Avatar for Galaxie 12. Galaxie Lv 1 69 pts. 8,867
  3. Avatar for frood66 13. frood66 Lv 1 67 pts. 8,855
  4. Avatar for Enzyme 14. Enzyme Lv 1 64 pts. 8,852
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 62 pts. 8,850
  6. Avatar for smilingone 16. smilingone Lv 1 60 pts. 8,837
  7. Avatar for altejoh 17. altejoh Lv 1 58 pts. 8,836
  8. Avatar for anthion 18. anthion Lv 1 56 pts. 8,833
  9. Avatar for bertro 19. bertro Lv 1 54 pts. 8,832
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 52 pts. 8,828

Comments