Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,606
  2. Avatar for Kotocycle 12. Kotocycle 2 pts. 8,583
  3. Avatar for Russian team 13. Russian team 1 pt. 8,572
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,501
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,453
  6. Avatar for xkcd 16. xkcd 1 pt. 8,429
  7. Avatar for :) 17. :) 1 pt. 7,865
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 7,317
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 6,804
  10. Avatar for BOINC@Poland 20. BOINC@Poland 1 pt. 5,999
  1. Avatar for Anfinsen_slept_here 41. Anfinsen_slept_here Lv 1 22 pts. 8,693
  2. Avatar for johngran 42. johngran Lv 1 21 pts. 8,689
  3. Avatar for caglar 43. caglar Lv 1 20 pts. 8,687
  4. Avatar for Mike Cassidy 44. Mike Cassidy Lv 1 19 pts. 8,684
  5. Avatar for tomespen 45. tomespen Lv 1 19 pts. 8,677
  6. Avatar for froggs554 46. froggs554 Lv 1 18 pts. 8,675
  7. Avatar for Crossed Sticks 47. Crossed Sticks Lv 1 17 pts. 8,669
  8. Avatar for Glen B 48. Glen B Lv 1 16 pts. 8,666
  9. Avatar for TastyMunchies 49. TastyMunchies Lv 1 15 pts. 8,664
  10. Avatar for shettler 50. shettler Lv 1 15 pts. 8,659

Comments