Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,606
  2. Avatar for Kotocycle 12. Kotocycle 2 pts. 8,583
  3. Avatar for Russian team 13. Russian team 1 pt. 8,572
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,501
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,453
  6. Avatar for xkcd 16. xkcd 1 pt. 8,429
  7. Avatar for :) 17. :) 1 pt. 7,865
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 7,317
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 6,804
  10. Avatar for BOINC@Poland 20. BOINC@Poland 1 pt. 5,999
  1. Avatar for petetrig 61. petetrig Lv 1 9 pts. 8,601
  2. Avatar for georg137 62. georg137 Lv 1 8 pts. 8,598
  3. Avatar for MicElephant 63. MicElephant Lv 1 8 pts. 8,597
  4. Avatar for carsonfb 64. carsonfb Lv 1 7 pts. 8,596
  5. Avatar for C_Elegans 65. C_Elegans Lv 1 7 pts. 8,584
  6. Avatar for Ikuso 66. Ikuso Lv 1 7 pts. 8,583
  7. Avatar for alcor29 67. alcor29 Lv 1 6 pts. 8,578
  8. Avatar for ciberhunter 68. ciberhunter Lv 1 6 pts. 8,572
  9. Avatar for YeshuaLives 69. YeshuaLives Lv 1 6 pts. 8,571
  10. Avatar for dbuske 70. dbuske Lv 1 5 pts. 8,569

Comments