1409: Revisiting Puzzle 135: E. coli
Closed since over 8 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- July 27, 2017
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW