Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,606
  2. Avatar for Kotocycle 12. Kotocycle 2 pts. 8,583
  3. Avatar for Russian team 13. Russian team 1 pt. 8,572
  4. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 8,453
  5. Avatar for xkcd 16. xkcd 1 pt. 8,429
  6. Avatar for :) 17. :) 1 pt. 7,865
  7. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 7,317
  8. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 6,804
  9. Avatar for BOINC@Poland 20. BOINC@Poland 1 pt. 5,999

  1. Avatar for Deleted player 81. Deleted player pts. 8,526
  2. Avatar for toshiue 82. toshiue Lv 1 3 pts. 8,524
  3. Avatar for SKSbell 83. SKSbell Lv 1 3 pts. 8,522
  4. Avatar for Simek 84. Simek Lv 1 2 pts. 8,512
  5. Avatar for leehaggis 85. leehaggis Lv 1 2 pts. 8,511
  6. Avatar for cobaltteal 86. cobaltteal Lv 1 2 pts. 8,502
  7. Avatar for versat82 87. versat82 Lv 1 2 pts. 8,501
  8. Avatar for senor pit 88. senor pit Lv 1 2 pts. 8,488
  9. Avatar for rabamino12358 89. rabamino12358 Lv 1 2 pts. 8,481
  10. Avatar for cbwest 90. cbwest Lv 1 2 pts. 8,477

Comments