Placeholder image of a protein
Icon representing a puzzle

1411: Unsolved De-novo Freestyle 113

Closed since over 8 years ago

Intermediate Overall Design

Summary


Created
August 01, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRERMEKWVEEVLRRIEEIIKKVTDKEQIEKEIRKLEKELRERIRQEDENSRLNIDVQIDQQDNHDEMRVEIRVELDGHEIRRRINVTK

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 2 pts. 9,360
  2. Avatar for xkcd 12. xkcd 1 pt. 9,324
  3. Avatar for Russian team 13. Russian team 1 pt. 9,265
  4. Avatar for Deleted group 14. Deleted group pts. 9,264
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 9,174
  6. Avatar for Italiani Al Lavoro 16. Italiani Al Lavoro 1 pt. 8,973
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,418
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 6,596
  9. Avatar for BMCB 658 Summer 2017 19. BMCB 658 Summer 2017 1 pt. 5,725

  1. Avatar for spvincent 21. spvincent Lv 1 50 pts. 9,667
  2. Avatar for tarimo 22. tarimo Lv 1 49 pts. 9,664
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 47 pts. 9,652
  4. Avatar for Susume 24. Susume Lv 1 45 pts. 9,651
  5. Avatar for crpainter 25. crpainter Lv 1 43 pts. 9,651
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 42 pts. 9,648
  7. Avatar for Timo van der Laan 27. Timo van der Laan Lv 1 40 pts. 9,639
  8. Avatar for Keresto 28. Keresto Lv 1 39 pts. 9,633
  9. Avatar for molleke 29. molleke Lv 1 37 pts. 9,585
  10. Avatar for reefyrob 30. reefyrob Lv 1 36 pts. 9,581

Comments


Susume Lv 1

This puzzle is an example where letting us mutate just a few (like maybe 3) residues (of our choosing) might result in an even more stable fold. For example, residues 82-86 IRRRI - 2 oranges separated by 3 blues - make psipred think the final structure is a helix. They might make it fold as a helix too. But I'd be willing to bet it was designed as a sheet. Substituting an orange for the middle R would convince psipred that it was a sheet, and might make it actually fold into a sheet more reliably than the given sequence does.

You could give us the protein with a few mutations allowed as a separate puzzle, if you don't want to mess up the results of whatever experiment you are currently doing with us predicting foldit designs.

You could find any solutions that resemble the original design, run those mutated sequences through Rosetta, and compare the results using only backbone atoms to the original design, to see if you get better funnel-shaped graphs.