Placeholder image of a protein
Icon representing a puzzle

1411: Unsolved De-novo Freestyle 113

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Design Design

Summary


Created
August 01, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRERMEKWVEEVLRRIEEIIKKVTDKEQIEKEIRKLEKELRERIRQEDENSRLNIDVQIDQQDNHDEMRVEIRVELDGHEIRRRINVTK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,933
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,925
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,890
  4. Avatar for Go Science 4. Go Science 41 pts. 9,794
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 9,785
  6. Avatar for Contenders 6. Contenders 20 pts. 9,732
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,698
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 9,652
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 9,585
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,421

  1. Avatar for ZAxel91 121. ZAxel91 Lv 1 1 pt. 8,274
  2. Avatar for carsonfb 122. carsonfb Lv 1 1 pt. 8,244
  3. Avatar for Superphosphate 123. Superphosphate Lv 1 1 pt. 8,208
  4. Avatar for pielie 124. pielie Lv 1 1 pt. 8,185
  5. Avatar for Jaco van As 125. Jaco van As Lv 1 1 pt. 8,105
  6. Avatar for bcre8tvv 126. bcre8tvv Lv 1 1 pt. 8,079
  7. Avatar for cobaltteal 127. cobaltteal Lv 1 1 pt. 8,039
  8. Avatar for joanieg 128. joanieg Lv 1 1 pt. 7,944
  9. Avatar for rinze 129. rinze Lv 1 1 pt. 7,911
  10. Avatar for lilovip 130. lilovip Lv 1 1 pt. 7,622

Comments


Susume Lv 1

This puzzle is an example where letting us mutate just a few (like maybe 3) residues (of our choosing) might result in an even more stable fold. For example, residues 82-86 IRRRI - 2 oranges separated by 3 blues - make psipred think the final structure is a helix. They might make it fold as a helix too. But I'd be willing to bet it was designed as a sheet. Substituting an orange for the middle R would convince psipred that it was a sheet, and might make it actually fold into a sheet more reliably than the given sequence does.

You could give us the protein with a few mutations allowed as a separate puzzle, if you don't want to mess up the results of whatever experiment you are currently doing with us predicting foldit designs.

You could find any solutions that resemble the original design, run those mutated sequences through Rosetta, and compare the results using only backbone atoms to the original design, to see if you get better funnel-shaped graphs.