Placeholder image of a protein
Icon representing a puzzle

1411: Unsolved De-novo Freestyle 113

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Design Design Design Design Design Design

Summary


Created
August 01, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ETRERMEKWVEEVLRRIEEIIKKVTDKEQIEKEIRKLEKELRERIRQEDENSRLNIDVQIDQQDNHDEMRVEIRVELDGHEIRRRINVTK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,933
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,925
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,890
  4. Avatar for Go Science 4. Go Science 41 pts. 9,794
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 9,785
  6. Avatar for Contenders 6. Contenders 20 pts. 9,732
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,698
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 9,652
  9. Avatar for FoldIt@Netherlands 9. FoldIt@Netherlands 6 pts. 9,585
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,421

  1. Avatar for cnhrcolemam 141. cnhrcolemam Lv 1 1 pt. 6,105
  2. Avatar for Tyrell 142. Tyrell Lv 1 1 pt. 5,885
  3. Avatar for JUSTICEfellow 143. JUSTICEfellow Lv 1 1 pt. 5,877
  4. Avatar for hc820404 144. hc820404 Lv 1 1 pt. 5,859
  5. Avatar for thdol2017 145. thdol2017 Lv 1 1 pt. 5,725
  6. Avatar for lutal2017 146. lutal2017 Lv 1 1 pt. 5,372
  7. Avatar for fujioyama 147. fujioyama Lv 1 1 pt. 5,345
  8. Avatar for 01010011111 148. 01010011111 Lv 1 1 pt. 2,784
  9. Avatar for multaq 149. multaq Lv 1 1 pt. 0
  10. Avatar for Hollinas 150. Hollinas Lv 1 1 pt. 0

Comments


Susume Lv 1

This puzzle is an example where letting us mutate just a few (like maybe 3) residues (of our choosing) might result in an even more stable fold. For example, residues 82-86 IRRRI - 2 oranges separated by 3 blues - make psipred think the final structure is a helix. They might make it fold as a helix too. But I'd be willing to bet it was designed as a sheet. Substituting an orange for the middle R would convince psipred that it was a sheet, and might make it actually fold into a sheet more reliably than the given sequence does.

You could give us the protein with a few mutations allowed as a separate puzzle, if you don't want to mess up the results of whatever experiment you are currently doing with us predicting foldit designs.

You could find any solutions that resemble the original design, run those mutated sequences through Rosetta, and compare the results using only backbone atoms to the original design, to see if you get better funnel-shaped graphs.