Placeholder image of a protein
Icon representing a puzzle

1412: Sketchbook Puzzle: Unsolved Denovo Freestyle 105

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
August 02, 2017
Expires
Max points
100
Description

Focus on your early game as we revisit puzzle 1381: Unsolved De-novo Freestyle 105. In this Sketchbook puzzle, you have 250 moves at your disposal. Once you use them up, you can reset and try something else!

TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 8,843
  2. Avatar for Kotocycle 12. Kotocycle 1 pt. 8,760
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 8,623
  4. Avatar for HMT heritage 14. HMT heritage 1 pt. 8,519
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 8,352
  6. Avatar for BMCB 658 Summer 2017 16. BMCB 658 Summer 2017 1 pt. 7,784
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 7,485
  8. Avatar for Window Group 18. Window Group 1 pt. 6,345
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 0

  1. Avatar for Squirrely 71. Squirrely Lv 1 5 pts. 8,869
  2. Avatar for poiuyqwert 72. poiuyqwert Lv 1 5 pts. 8,864
  3. Avatar for NotJim99 73. NotJim99 Lv 1 4 pts. 8,864
  4. Avatar for shettler 74. shettler Lv 1 4 pts. 8,862
  5. Avatar for stomjoh 75. stomjoh Lv 1 4 pts. 8,861
  6. Avatar for Merf 76. Merf Lv 1 4 pts. 8,861
  7. Avatar for weitzen 77. weitzen Lv 1 4 pts. 8,861
  8. Avatar for jamiexq 78. jamiexq Lv 1 3 pts. 8,857
  9. Avatar for mitarcher 79. mitarcher Lv 1 3 pts. 8,844
  10. Avatar for Mr_Jolty 80. Mr_Jolty Lv 1 3 pts. 8,843

Comments


jeff101 Lv 1

Somehow, despite the many possible structures for a given protein sequence, nature quickly folds a protein into a specific stable structure. See https://en.wikipedia.org/wiki/Levinthal%27s_paradox for example.

In this sketchbook type of puzzle, I can see a player taking his/her best solution and trying to fold it again with a smaller number of moves. Then the player can use the extra moves remaining to find an even better solution. In effect, this will encourage players to explore the folding pathway and find the most direct ways to reach the best folds. The most efficient series of moves for the best solutions would make interesting movies that could help train human folders and might even resemble the true folding pathways used in nature. They would also make useful training sets for artificial intelligence and neural networks. See https://fold.it/portal/node/2002918 for example.

alcor29 Lv 1

Thank you for posting this Jeff. It makes me feel somewhat less ignorant. Though not remotely connected to biochemistry I have now long wondered if all the grinding done for points creates a false gamification artifact as opposed to a greater scientific validation. The path that is described by Levinthal coincides with my speculation that a string of amino acids may fold unto itself in accordance with the first likely encounters of the intermolecular forces. This has meant for me, that when we concentrate on grinding points for the game competition by ensuring that we are not in a "local" minima, we may actually be kicking the fold out of the local minima which the protein "prefers" in the real world of its milieu. I wonder how many other folders have felt the same thing.
( https://en.wikipedia.org/wiki/Levinthal%27s_paradox )

frood66 Lv 1

Since (it would appear) we are going to be spending more time working out how many 'moves' we have made (some of those that count appearing apocryphal at best) Would it be unfair to ask the science behind this latest puzzle type. So far as I can see at the moment, it looks like a game for game's sake.Or as many B4 have described similar ideas….another 'Lab Rat Job'

Sorry if that sounds harsh - but it's only history.

frood66 Lv 1

I think, with respect, u r missing an important point. Many hand folders work at low cI and Low wiggle power for a long time B4 they 'move up'. They do all this in 'blind belief' that they are creating a good fold. Doing this strategy takes a great deal of moves. So - with respect - I think u totally misunderstand.

gitwut Lv 1

It would also be more helpful to have the filter show something like "Moves made: 0, moves remaining: 250" or similar, since I imagine different puzzles might vary the number of maximum moves allowed. It would help to see that reflected by the filter.

I frequently run multiple poses on each denovo and monomer puzzle. I had four different track poses (much friendlier than reset, btw) for denovo 1405. Are all of them analyzed? Why can't the same data be extracted from the early folds of that?

Will all tracks of Sketchbook puzzles analyzed? If so, I'd prefer to use them instead of reset.

"With that in mind, we're interested in a puzzle that refocuses folding effort on the early-game, rewarding you for trying something new instead of drilling on an existing fold."

I'm not sure how allowing us to reset a puzzle and starting over with limited moves is a "reward". We've always had the ability to reset a puzzle.

gitwut Lv 1

I created one pose, no scripts, saved my work and then tried to open shared folders. Client locked up. These puzzles are entirely inefficient effort-wise and time-wise due to the far too limited move constraints and buggy client. I could have accomplished the same thing handfolding only in 1/4 of the time if I weren't so worried about minimizing my moves. The way I approach denovos (minus the move constraint), is already the same, but with better results.

I thought it only fair to at least try this puzzle type and, sad to say, most all of my concerns appear accurate. This puzzle type, and the client, needs serious re-consideration and re-working. Until then, I won't waste any more time on them.

eusair Lv 1

all this folding pathways stuff does not require 'moves' in order to be studied. assuming pathways can be studied at all (see below) in foldit, it could just as easily, no, more easily be studied using a simple timer.

keep in mind the fact that nature doesn't have bands or cuts or idealize structure buttons; nor the hands and mind of a human player/chaperone. foldit is not a folding simulator. protein structures are not arrived at in a way that at all resembles that in nature.

eusair Lv 1

aye, its merely a game within a game. let's find out who wants to spend the most time getting the most out of each and every move. atm that means before you shake, add bands to every aa you want to end up a particular way. same thing with every wiggle. believe me, i've tried it. i've spent 20-30 mins preparing for a single shake. i press the Z button enough as it is. i don't see myself carrying on in that fashion for no reason, or for what seems to me atm to be unfounded and ill-conceived reasons.

Aubade01 Lv 1

It appears obvious that all players of this Sketchbook puzzle are not on an equal footing. Players should start equal since moves are limited. Since this puzzle is based on the old puzzle 1381: Unsolved De-novo Freestyle 105, players who have the top fold pose stored on their computers, or are members of a group who have that top pose, have the advantage. Players who did not discover the top pose in 1381 or are trying it for the first time cannot possible score well in 250 moves. If Foldit is really serious about Sketchbooks starting as old De-novo, then a link to the top pose image should be available. We should all know at the start how the coils and sheets are aligned.

Aubade00 / 01