Placeholder image of a protein
Icon representing a puzzle

1412: Sketchbook Puzzle: Unsolved Denovo Freestyle 105

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
August 02, 2017
Expires
Max points
100
Description

Focus on your early game as we revisit puzzle 1381: Unsolved De-novo Freestyle 105. In this Sketchbook puzzle, you have 250 moves at your disposal. Once you use them up, you can reset and try something else!

TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,474
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 9,435
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,420
  4. Avatar for Void Crushers 4. Void Crushers 41 pts. 9,290
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 9,282
  6. Avatar for Go Science 6. Go Science 20 pts. 9,270
  7. Avatar for Deleted group 7. Deleted group pts. 9,160
  8. Avatar for Contenders 8. Contenders 9 pts. 9,104
  9. Avatar for Russian team 9. Russian team 6 pts. 8,969
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 4 pts. 8,903

  1. Avatar for mirjamvandelft 121. mirjamvandelft Lv 1 1 pt. 8,417
  2. Avatar for joanieg 122. joanieg Lv 1 1 pt. 8,411
  3. Avatar for Arne Heessels 123. Arne Heessels Lv 1 1 pt. 8,387
  4. Avatar for Mao Mao 124. Mao Mao Lv 1 1 pt. 8,377
  5. Avatar for toshiue 125. toshiue Lv 1 1 pt. 8,375
  6. Avatar for lamoille 126. lamoille Lv 1 1 pt. 8,369
  7. Avatar for deLaCeiba 127. deLaCeiba Lv 1 1 pt. 8,352
  8. Avatar for Threeoak 128. Threeoak Lv 1 1 pt. 8,329
  9. Avatar for Mitzi13 129. Mitzi13 Lv 1 1 pt. 8,292
  10. Avatar for crpainter 130. crpainter Lv 1 1 pt. 8,172

Comments


Susume Lv 1

There is a picture of the protein in the blog for all to see - scroll down to the one from Waya, Galaxie, Susume from puzzle 1297.

Aubade01 Lv 1

Puzzle appears to be a design not De-novo.

"1297: 65 Residue Monomer Design: No Rebuilding!"

Blog picture 1297 has only a single coil not the two in Sketchbook.

I was thinking more along the lines of a picture link embedded in the puzzle description. We should be encouraging new players and not expect them to know everything veterans know.

Aubade00 / 01

LociOiling Lv 1

The protein in this puzzle is the first Foldit player design to be grown, crystallized, and solved by X-ray diffraction.

As Susume mentions, the protein was created in puzzle 1297. After the wet lab, it was presented as a de-novo in puzzle 1381, and an electron density in puzzle 1384.

See Design Puzzle Results on the wiki, which includes a nice image posted by Waya for 1297. The Puzzle 1381 gallery shows the protein from two angles.

I'm still not convinced about the sketchbook format, but we've had lots of practice with this particular protein already. I'm sure it will end up the PDB someday soon.

Bruno Kestemont Lv 1

For us, "early game" (hand fold and "observing" the protein) is the most (human) time consuming. This is also our most valuable contribution for this project. Overnight scripts or "moves" are almost "for free" (concerning Human resources). So the question is not the number of moves but to encourage us to spend more "hand fold" time.

Suggestion (just brain storming)

Game in 2 (3) rounds:
1-one round pure hand fold and no score (no rank, no points, no scripts unless GUI, no share)
2-one almost normal round with possibility to load solutions from round 1 in different identified unique tracks- At the end of this round, the score is not immediately calculated according to the apparent top solution's rank BUT …
3-A definitive score and ranking "round" where the player's score and rank is the sum of the 2 current best separate original solutions (at an unique separate paths starting in round 1 ending round 2).

In round 1, my strategy would be to try as many and diverse manual designs as possible, regardless of scores.

In round 2, I'll develop the full potential of several of them in order to also find the second best one.

I use the "decreasing return" property of the puzzles. If I see that my best solution is near to its mojo (gaining few points a day), I'll be encouraged to concentrate on second best solutions with higher "points a day" potential, in order to maximize the sum of my 2 best separate solutions.

Not sure it works. Just thinking.