Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531

  1. Avatar for nicobul 11. nicobul Lv 1 72 pts. 9,439
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 70 pts. 9,439
  3. Avatar for Enzyme 13. Enzyme Lv 1 67 pts. 9,428
  4. Avatar for fiendish_ghoul 14. fiendish_ghoul Lv 1 65 pts. 9,394
  5. Avatar for hansvandenhof 15. hansvandenhof Lv 1 63 pts. 9,389
  6. Avatar for reefyrob 16. reefyrob Lv 1 60 pts. 9,375
  7. Avatar for gmn 17. gmn Lv 1 58 pts. 9,372
  8. Avatar for caglar 18. caglar Lv 1 56 pts. 9,361
  9. Avatar for gitwut 19. gitwut Lv 1 54 pts. 9,359
  10. Avatar for mimi 20. mimi Lv 1 52 pts. 9,354

Comments


gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.