Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,608
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,597
  3. Avatar for Go Science 3. Go Science 56 pts. 9,469
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 9,446
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,428
  7. Avatar for Contenders 7. Contenders 14 pts. 9,366
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,330
  9. Avatar for xkcd 9. xkcd 6 pts. 9,177
  10. Avatar for Deleted group 10. Deleted group pts. 9,058
  1. Avatar for nicobul 11. nicobul Lv 1 72 pts. 9,439
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 70 pts. 9,439
  3. Avatar for Enzyme 13. Enzyme Lv 1 67 pts. 9,428
  4. Avatar for fiendish_ghoul 14. fiendish_ghoul Lv 1 65 pts. 9,394
  5. Avatar for hansvandenhof 15. hansvandenhof Lv 1 63 pts. 9,389
  6. Avatar for reefyrob 16. reefyrob Lv 1 60 pts. 9,375
  7. Avatar for gmn 17. gmn Lv 1 58 pts. 9,372
  8. Avatar for caglar 18. caglar Lv 1 56 pts. 9,361
  9. Avatar for gitwut 19. gitwut Lv 1 54 pts. 9,359
  10. Avatar for mimi 20. mimi Lv 1 52 pts. 9,354

Comments

gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.