Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531

  1. Avatar for grogar7 21. grogar7 Lv 1 50 pts. 9,353
  2. Avatar for phi16 22. phi16 Lv 1 49 pts. 9,347
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 47 pts. 9,342
  4. Avatar for smilingone 24. smilingone Lv 1 45 pts. 9,342
  5. Avatar for tarimo 25. tarimo Lv 1 43 pts. 9,332
  6. Avatar for Timo van der Laan 26. Timo van der Laan Lv 1 42 pts. 9,330
  7. Avatar for Susume 27. Susume Lv 1 40 pts. 9,330
  8. Avatar for spvincent 28. spvincent Lv 1 39 pts. 9,325
  9. Avatar for eusair 29. eusair Lv 1 37 pts. 9,299
  10. Avatar for actiasluna 30. actiasluna Lv 1 36 pts. 9,294

Comments


gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.