Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,608
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,597
  3. Avatar for Go Science 3. Go Science 56 pts. 9,469
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 9,446
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,428
  7. Avatar for Contenders 7. Contenders 14 pts. 9,366
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,330
  9. Avatar for xkcd 9. xkcd 6 pts. 9,177
  10. Avatar for Deleted group 10. Deleted group pts. 9,058
  1. Avatar for grogar7 21. grogar7 Lv 1 50 pts. 9,353
  2. Avatar for phi16 22. phi16 Lv 1 49 pts. 9,347
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 47 pts. 9,342
  4. Avatar for smilingone 24. smilingone Lv 1 45 pts. 9,342
  5. Avatar for tarimo 25. tarimo Lv 1 43 pts. 9,332
  6. Avatar for Timo van der Laan 26. Timo van der Laan Lv 1 42 pts. 9,330
  7. Avatar for Susume 27. Susume Lv 1 40 pts. 9,330
  8. Avatar for spvincent 28. spvincent Lv 1 39 pts. 9,325
  9. Avatar for eusair 29. eusair Lv 1 37 pts. 9,299
  10. Avatar for actiasluna 30. actiasluna Lv 1 36 pts. 9,294

Comments

gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.