Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531

  1. Avatar for kabubi 41. kabubi Lv 1 23 pts. 9,224
  2. Avatar for jobo0502 42. jobo0502 Lv 1 22 pts. 9,189
  3. Avatar for toshiue 43. toshiue Lv 1 21 pts. 9,178
  4. Avatar for fryguy 44. fryguy Lv 1 20 pts. 9,177
  5. Avatar for johnmitch 45. johnmitch Lv 1 19 pts. 9,158
  6. Avatar for Tehnologik1 46. Tehnologik1 Lv 1 18 pts. 9,151
  7. Avatar for Mike Cassidy 47. Mike Cassidy Lv 1 17 pts. 9,130
  8. Avatar for Anfinsen_slept_here 48. Anfinsen_slept_here Lv 1 17 pts. 9,121
  9. Avatar for Scopper 49. Scopper Lv 1 16 pts. 9,120
  10. Avatar for heather-1 50. heather-1 Lv 1 15 pts. 9,102

Comments


gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.