Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,608
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,597
  3. Avatar for Go Science 3. Go Science 56 pts. 9,469
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 9,446
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,428
  7. Avatar for Contenders 7. Contenders 14 pts. 9,366
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,330
  9. Avatar for xkcd 9. xkcd 6 pts. 9,177
  10. Avatar for Deleted group 10. Deleted group pts. 9,058
  1. Avatar for kabubi 41. kabubi Lv 1 23 pts. 9,224
  2. Avatar for jobo0502 42. jobo0502 Lv 1 22 pts. 9,189
  3. Avatar for toshiue 43. toshiue Lv 1 21 pts. 9,178
  4. Avatar for fryguy 44. fryguy Lv 1 20 pts. 9,177
  5. Avatar for johnmitch 45. johnmitch Lv 1 19 pts. 9,158
  6. Avatar for Tehnologik1 46. Tehnologik1 Lv 1 18 pts. 9,151
  7. Avatar for Mike Cassidy 47. Mike Cassidy Lv 1 17 pts. 9,130
  8. Avatar for Anfinsen_slept_here 48. Anfinsen_slept_here Lv 1 17 pts. 9,121
  9. Avatar for Scopper 49. Scopper Lv 1 16 pts. 9,120
  10. Avatar for heather-1 50. heather-1 Lv 1 15 pts. 9,102

Comments

gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.