Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 2 pts. 9,024
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,820
  3. Avatar for Russian team 13. Russian team 1 pt. 8,640
  4. Avatar for Eὕρηκα! Heureka! 14. Eὕρηκα! Heureka! 1 pt. 8,520
  5. Avatar for Bad Monkey 15. Bad Monkey 1 pt. 8,458
  6. Avatar for freefolder 16. freefolder 1 pt. 7,736
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,263
  8. Avatar for BMCB 658 Summer 2017 18. BMCB 658 Summer 2017 1 pt. 6,531
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 0
  1. Avatar for Crossed Sticks 51. Crossed Sticks Lv 1 15 pts. 9,102
  2. Avatar for SWR_DMaster 52. SWR_DMaster Lv 1 14 pts. 9,098
  3. Avatar for guineapig 53. guineapig Lv 1 13 pts. 9,092
  4. Avatar for Deleted player 54. Deleted player pts. 9,091
  5. Avatar for WBarme1234 55. WBarme1234 Lv 1 12 pts. 9,088
  6. Avatar for Soggy Doglog 56. Soggy Doglog Lv 1 11 pts. 9,069
  7. Avatar for diamonddays 57. diamonddays Lv 1 11 pts. 9,066
  8. Avatar for drumpeter18yrs9yrs 58. drumpeter18yrs9yrs Lv 1 10 pts. 9,058
  9. Avatar for manu8170 59. manu8170 Lv 1 10 pts. 9,050
  10. Avatar for TastyMunchies 60. TastyMunchies Lv 1 9 pts. 9,043

Comments

gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.