Placeholder image of a protein
Icon representing a puzzle

1414: Unsolved De-novo 114

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 09, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEIDIQTQSKGHTRVRMRTEHSEWEITIRTTNEDELRERLRREFEKIKKEHDREEIKKELKKIEEEIQKQIE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,608
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,597
  3. Avatar for Go Science 3. Go Science 56 pts. 9,469
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 9,446
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 9,439
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 9,428
  7. Avatar for Contenders 7. Contenders 14 pts. 9,366
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 9,330
  9. Avatar for xkcd 9. xkcd 6 pts. 9,177
  10. Avatar for Deleted group 10. Deleted group pts. 9,058

  1. Avatar for Crossed Sticks 51. Crossed Sticks Lv 1 15 pts. 9,102
  2. Avatar for SWR_DMaster 52. SWR_DMaster Lv 1 14 pts. 9,098
  3. Avatar for guineapig 53. guineapig Lv 1 13 pts. 9,092
  4. Avatar for Deleted player 54. Deleted player pts. 9,091
  5. Avatar for WBarme1234 55. WBarme1234 Lv 1 12 pts. 9,088
  6. Avatar for Soggy Doglog 56. Soggy Doglog Lv 1 11 pts. 9,069
  7. Avatar for diamonddays 57. diamonddays Lv 1 11 pts. 9,066
  8. Avatar for drumpeter18yrs9yrs 58. drumpeter18yrs9yrs Lv 1 10 pts. 9,058
  9. Avatar for manu8170 59. manu8170 Lv 1 10 pts. 9,050
  10. Avatar for TastyMunchies 60. TastyMunchies Lv 1 9 pts. 9,043

Comments


gitwut Lv 1

Client IRC rarely stays connected long enough to receive notifications. I received no notice for the expiration of puzzle 1412 nor for the opening of this one.

Please concentrate more on improving the player experience and less on useless new puzzle types that make it worse.