Placeholder image of a protein
Icon representing a puzzle

1415: Revisiting Puzzle 136: Cell Adhesion

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 10, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,026
  2. Avatar for Russian team 12. Russian team 1 pt. 8,589
  3. Avatar for freefolder 13. freefolder 1 pt. 8,264
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,444

  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 9,561
  2. Avatar for Enzyme 2. Enzyme Lv 1 80 pts. 9,560
  3. Avatar for Skippysk8s 3. Skippysk8s Lv 1 63 pts. 9,557
  4. Avatar for andrewxc 4. andrewxc Lv 1 49 pts. 9,554
  5. Avatar for Blipperman 5. Blipperman Lv 1 37 pts. 9,541
  6. Avatar for Norrjane 6. Norrjane Lv 1 28 pts. 9,537
  7. Avatar for georg137 7. georg137 Lv 1 21 pts. 9,470
  8. Avatar for Galaxie 8. Galaxie Lv 1 15 pts. 9,464
  9. Avatar for LociOiling 9. LociOiling Lv 1 11 pts. 9,458
  10. Avatar for lamoille 10. lamoille Lv 1 8 pts. 9,456

Comments