1415: Revisiting Puzzle 136: Cell Adhesion

Closed since over 8 years ago

Summary

• Created: August 10, 2017
• Expires: August 17, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

• 1. Contenders 100 pts. 9,570
• 2. Gargleblasters 68 pts. 9,561
• 3. Anthropic Dreams 44 pts. 9,489
• 4. Void Crushers 27 pts. 9,476
• 5. Beta Folders 16 pts. 9,459
• 6. Go Science 9 pts. 9,449
• 7. L'Alliance Francophone 5 pts. 9,399
• 8. Marvin's bunch 3 pts. 9,390
• 9. HMT heritage 1 pt. 9,149
• 10. Italiani Al Lavoro 1 pt. 9,057

Top soloists

• 1. Glen B 100 pts. 9,824
• 2. gitwut 97 pts. 9,570
• 3. Enzyme 93 pts. 9,552
• 4. eusair 90 pts. 9,493
• 5. markm457 86 pts. 9,489
• 6. Skippysk8s 83 pts. 9,488
• 7. Blipperman 80 pts. 9,480
• 8. actiasluna 77 pts. 9,477
• 9. Timo van der Laan 74 pts. 9,476
• 10. dcrwheeler 71 pts. 9,476