Placeholder image of a protein
Icon representing a puzzle

1415: Revisiting Puzzle 136: Cell Adhesion

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,026
  2. Avatar for Russian team 12. Russian team 1 pt. 8,589
  3. Avatar for freefolder 13. freefolder 1 pt. 8,264
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,444
  1. Avatar for joanieg 101. joanieg Lv 1 1 pt. 7,996
  2. Avatar for FishKAA 102. FishKAA Lv 1 1 pt. 7,968
  3. Avatar for Hollinas 103. Hollinas Lv 1 1 pt. 7,935
  4. Avatar for jebbiek 104. jebbiek Lv 1 1 pt. 7,917
  5. Avatar for Martinius 105. Martinius Lv 1 1 pt. 7,887
  6. Avatar for roman madala 106. roman madala Lv 1 1 pt. 7,882
  7. Avatar for rinze 107. rinze Lv 1 1 pt. 7,838
  8. Avatar for Mao Mao 108. Mao Mao Lv 1 1 pt. 7,823
  9. Avatar for Iron pet 109. Iron pet Lv 1 1 pt. 7,786
  10. Avatar for Tehnologik1 110. Tehnologik1 Lv 1 1 pt. 7,784

Comments