Placeholder image of a protein
Icon representing a puzzle

1415: Revisiting Puzzle 136: Cell Adhesion

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,026
  2. Avatar for Russian team 12. Russian team 1 pt. 8,589
  3. Avatar for freefolder 13. freefolder 1 pt. 8,264
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,444
  1. Avatar for xabxs 111. xabxs Lv 1 1 pt. 7,755
  2. Avatar for royb3 112. royb3 Lv 1 1 pt. 7,696
  3. Avatar for martinf 113. martinf Lv 1 1 pt. 7,685
  4. Avatar for makeitwork 114. makeitwork Lv 1 1 pt. 7,670
  5. Avatar for Scopper 115. Scopper Lv 1 1 pt. 7,649
  6. Avatar for TheGUmmer 116. TheGUmmer Lv 1 1 pt. 7,643
  7. Avatar for cnhrcolemam 117. cnhrcolemam Lv 1 1 pt. 7,633
  8. Avatar for Squirrely 118. Squirrely Lv 1 1 pt. 7,611
  9. Avatar for Sydefecks 119. Sydefecks Lv 1 1 pt. 7,593
  10. Avatar for Toudi_Ogr 120. Toudi_Ogr Lv 1 1 pt. 7,591

Comments