Placeholder image of a protein
Icon representing a puzzle

1415: Revisiting Puzzle 136: Cell Adhesion

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 10, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,026
  2. Avatar for Russian team 12. Russian team 1 pt. 8,589
  3. Avatar for freefolder 13. freefolder 1 pt. 8,264
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,444

  1. Avatar for jbmkfm125 121. jbmkfm125 Lv 1 1 pt. 7,565
  2. Avatar for mirjamvandelft 122. mirjamvandelft Lv 1 1 pt. 7,540
  3. Avatar for momadoc 123. momadoc Lv 1 1 pt. 7,539
  4. Avatar for wolfshape 124. wolfshape Lv 1 1 pt. 7,531
  5. Avatar for franse 125. franse Lv 1 1 pt. 7,528
  6. Avatar for parsnip 126. parsnip Lv 1 1 pt. 7,499
  7. Avatar for aspadistra 127. aspadistra Lv 1 1 pt. 7,444
  8. Avatar for larry25427 128. larry25427 Lv 1 1 pt. 7,442
  9. Avatar for lamoille 129. lamoille Lv 1 1 pt. 7,407
  10. Avatar for Andrudja 130. Andrudja Lv 1 1 pt. 7,362

Comments