1415: Revisiting Puzzle 136: Cell Adhesion
Closed since over 8 years ago
Intermediate Overall PredictionSummary
- Created
- August 10, 2017
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
