Placeholder image of a protein
Icon representing a puzzle

1415: Revisiting Puzzle 136: Cell Adhesion

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,026
  2. Avatar for Russian team 12. Russian team 1 pt. 8,589
  3. Avatar for freefolder 13. freefolder 1 pt. 8,264
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,444
  1. Avatar for jausmh 31. jausmh Lv 1 29 pts. 9,358
  2. Avatar for guineapig 32. guineapig Lv 1 27 pts. 9,327
  3. Avatar for georg137 33. georg137 Lv 1 26 pts. 9,324
  4. Avatar for petetrig 34. petetrig Lv 1 25 pts. 9,319
  5. Avatar for christioanchauvin 35. christioanchauvin Lv 1 24 pts. 9,316
  6. Avatar for Norrjane 36. Norrjane Lv 1 23 pts. 9,310
  7. Avatar for smilingone 37. smilingone Lv 1 21 pts. 9,310
  8. Avatar for tarimo 38. tarimo Lv 1 20 pts. 9,297
  9. Avatar for diamonddays 39. diamonddays Lv 1 19 pts. 9,294
  10. Avatar for pvc78 40. pvc78 Lv 1 18 pts. 9,283

Comments