Placeholder image of a protein
Icon representing a puzzle

1415: Revisiting Puzzle 136: Cell Adhesion

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 10, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,026
  2. Avatar for Russian team 12. Russian team 1 pt. 8,589
  3. Avatar for freefolder 13. freefolder 1 pt. 8,264
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,444
  1. Avatar for O Seki To 51. O Seki To Lv 1 10 pts. 9,149
  2. Avatar for Crossed Sticks 52. Crossed Sticks Lv 1 10 pts. 9,136
  3. Avatar for pfirth 53. pfirth Lv 1 9 pts. 9,129
  4. Avatar for alwen 54. alwen Lv 1 9 pts. 9,080
  5. Avatar for deLaCeiba 55. deLaCeiba Lv 1 8 pts. 9,057
  6. Avatar for stomjoh 56. stomjoh Lv 1 8 pts. 9,044
  7. Avatar for dizzywings 57. dizzywings Lv 1 7 pts. 9,036
  8. Avatar for Mydogisa Toelicker 58. Mydogisa Toelicker Lv 1 7 pts. 9,033
  9. Avatar for Deleted player 59. Deleted player pts. 9,032
  10. Avatar for Mr_Jolty 60. Mr_Jolty Lv 1 6 pts. 9,026

Comments