Placeholder image of a protein
Icon representing a puzzle

1415: Revisiting Puzzle 136: Cell Adhesion

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
August 10, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Contenders 100 pts. 9,570
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 9,561
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 9,489
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 9,476
  5. Avatar for Beta Folders 5. Beta Folders 16 pts. 9,459
  6. Avatar for Go Science 6. Go Science 9 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,399
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,390
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,149
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,057

  1. Avatar for tomespen 71. tomespen Lv 1 3 pts. 8,828
  2. Avatar for Merf 72. Merf Lv 1 3 pts. 8,825
  3. Avatar for froggs554 73. froggs554 Lv 1 3 pts. 8,746
  4. Avatar for frostschutz 74. frostschutz Lv 1 2 pts. 8,731
  5. Avatar for ppp6 75. ppp6 Lv 1 2 pts. 8,717
  6. Avatar for lupussapien 76. lupussapien Lv 1 2 pts. 8,638
  7. Avatar for carsonfb 77. carsonfb Lv 1 2 pts. 8,637
  8. Avatar for fpc 78. fpc Lv 1 2 pts. 8,619
  9. Avatar for cobaltteal 79. cobaltteal Lv 1 2 pts. 8,608
  10. Avatar for hada 80. hada Lv 1 2 pts. 8,602

Comments