Placeholder image of a protein
Icon representing a puzzle

1415: Revisiting Puzzle 136: Cell Adhesion

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 10, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Contenders 100 pts. 9,570
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 9,561
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 9,489
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 9,476
  5. Avatar for Beta Folders 5. Beta Folders 16 pts. 9,459
  6. Avatar for Go Science 6. Go Science 9 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,399
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,390
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,149
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,057

  1. Avatar for hansvandenhof 41. hansvandenhof Lv 1 17 pts. 9,266
  2. Avatar for andrewxc 42. andrewxc Lv 1 17 pts. 9,261
  3. Avatar for MicElephant 43. MicElephant Lv 1 16 pts. 9,240
  4. Avatar for WBarme1234 44. WBarme1234 Lv 1 15 pts. 9,219
  5. Avatar for joremen 45. joremen Lv 1 14 pts. 9,207
  6. Avatar for jobo0502 46. jobo0502 Lv 1 13 pts. 9,207
  7. Avatar for isaksson 47. isaksson Lv 1 13 pts. 9,180
  8. Avatar for alcor29 48. alcor29 Lv 1 12 pts. 9,162
  9. Avatar for toshiue 49. toshiue Lv 1 11 pts. 9,160
  10. Avatar for Vinara 50. Vinara Lv 1 11 pts. 9,150

Comments