Placeholder image of a protein
Icon representing a puzzle

1418: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
August 17, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,508
  2. Avatar for xkcd 12. xkcd 1 pt. 9,401
  3. Avatar for freefolder 13. freefolder 1 pt. 9,393
  4. Avatar for Deleted group 14. Deleted group pts. 9,288
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,124
  1. Avatar for alrianne 81. alrianne Lv 1 3 pts. 9,529
  2. Avatar for Mydogisa Toelicker 82. Mydogisa Toelicker Lv 1 2 pts. 9,527
  3. Avatar for Soggy Doglog 83. Soggy Doglog Lv 1 2 pts. 9,525
  4. Avatar for hada 84. hada Lv 1 2 pts. 9,520
  5. Avatar for Ikuso 85. Ikuso Lv 1 2 pts. 9,519
  6. Avatar for jebbiek 86. jebbiek Lv 1 2 pts. 9,514
  7. Avatar for Mr_Jolty 87. Mr_Jolty Lv 1 2 pts. 9,508
  8. Avatar for pandapharmd 88. pandapharmd Lv 1 2 pts. 9,505
  9. Avatar for leehaggis 89. leehaggis Lv 1 2 pts. 9,499
  10. Avatar for Thebatman012 90. Thebatman012 Lv 1 2 pts. 9,499

Comments