Placeholder image of a protein
Icon representing a puzzle

1420: Unsolved De-novo Freestyle 116

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 20, 2017
Expires
Max points
100
Description

Note: Due to scoreboard instabilities, the deadline for this puzzle has been extended 24 hours, to August 30 at 23:00 UTC.



The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MVNEFHGREFQCAQYVPSGPGYENISRSNQVCTAVGSVPGNEMVSGTNYLAGAYQYYNSHKW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 8,685
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 8,661
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 8,650
  4. Avatar for Contenders 4. Contenders 33 pts. 8,636
  5. Avatar for Go Science 5. Go Science 22 pts. 8,627
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 8,563
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 8,467
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 8,447
  9. Avatar for xkcd 9. xkcd 3 pts. 8,283
  10. Avatar for Kotocycle 10. Kotocycle 2 pts. 8,248

  1. Avatar for Festering Wounds 101. Festering Wounds Lv 1 1 pt. 7,803
  2. Avatar for karost 102. karost Lv 1 1 pt. 7,794
  3. Avatar for Mr_Jolty 103. Mr_Jolty Lv 1 1 pt. 7,787
  4. Avatar for rinze 104. rinze Lv 1 1 pt. 7,783
  5. Avatar for Deleted player 105. Deleted player pts. 7,779
  6. Avatar for ViJay7019 106. ViJay7019 Lv 1 1 pt. 7,749
  7. Avatar for Maharball 107. Maharball Lv 1 1 pt. 7,738
  8. Avatar for aussiesnrg 108. aussiesnrg Lv 1 1 pt. 7,736
  9. Avatar for poiuyqwert 109. poiuyqwert Lv 1 1 pt. 7,710
  10. Avatar for Arne Heessels 110. Arne Heessels Lv 1 1 pt. 7,702

Comments


LociOiling Lv 1

The Foldit team has extended the expiration of this puzzle by 24 hours due to problems with in-game scoreboards not updating.

See my forum post describing the issues:

http://fold.it/portal/node/2004117

The scoreboards appear to be working again, but this was the second time the issue struck in only a few days.

You may see "rank down" messages in your Foldit game clients when the scoreboards start getting updated….