1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Summary

• Created: September 12, 2017
• Expires: September 20, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

• 1. Beta Folders 100 pts. 9,992
• 2. Gargleblasters 73 pts. 9,971
• 3. Anthropic Dreams 52 pts. 9,941
• 4. Void Crushers 36 pts. 9,938
• 5. Go Science 24 pts. 9,926
• 6. Contenders 16 pts. 9,923
• 7. L'Alliance Francophone 10 pts. 9,923
• 8. HMT heritage 6 pts. 9,893
• 9. Marvin's bunch 4 pts. 9,880
• 10. Natural Abilities 2 pts. 9,714

Top soloists

• 1. LociOiling 100 pts. 9,992
• 2. Enzyme 98 pts. 9,971
• 3. actiasluna 95 pts. 9,947
• 4. Galaxie 92 pts. 9,941
• 5. Timo van der Laan 89 pts. 9,938
• 6. retiredmichael 86 pts. 9,929
• 7. Bruno Kestemont 84 pts. 9,926
• 8. Bletchley Park 81 pts. 9,923
• 9. nicobul 78 pts. 9,923
• 10. smilingone 76 pts. 9,912