Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 9,656
  2. Avatar for :) 12. :) 1 pt. 9,468
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,278
  4. Avatar for Deleted group 14. Deleted group pts. 9,153
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,127
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 9,036
  7. Avatar for Window Group 17. Window Group 1 pt. 8,310

  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 9,989
  2. Avatar for LociOiling 2. LociOiling Lv 1 81 pts. 9,986
  3. Avatar for smilingone 3. smilingone Lv 1 65 pts. 9,984
  4. Avatar for Enzyme 4. Enzyme Lv 1 52 pts. 9,958
  5. Avatar for actiasluna 5. actiasluna Lv 1 41 pts. 9,957
  6. Avatar for Skippysk8s 6. Skippysk8s Lv 1 32 pts. 9,956
  7. Avatar for Galaxie 7. Galaxie Lv 1 24 pts. 9,941
  8. Avatar for phi16 8. phi16 Lv 1 18 pts. 9,937
  9. Avatar for lamoille 9. lamoille Lv 1 14 pts. 9,936
  10. Avatar for gmn 10. gmn Lv 1 10 pts. 9,933

Comments