Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 9,656
  2. Avatar for :) 12. :) 1 pt. 9,468
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,278
  4. Avatar for Deleted group 14. Deleted group pts. 9,153
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,127
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 9,036
  7. Avatar for Window Group 17. Window Group 1 pt. 8,310

  1. Avatar for justjustin 141. justjustin Lv 1 1 pt. 9,032
  2. Avatar for zladkovich 142. zladkovich Lv 1 1 pt. 9,020
  3. Avatar for saugusfc 143. saugusfc Lv 1 1 pt. 8,990
  4. Avatar for Colerw22 144. Colerw22 Lv 1 1 pt. 8,950
  5. Avatar for Morhiodol 145. Morhiodol Lv 1 1 pt. 8,743
  6. Avatar for Deleted player 146. Deleted player pts. 8,622
  7. Avatar for mtjeric 147. mtjeric Lv 1 1 pt. 8,455
  8. Avatar for christinecruzz 148. christinecruzz Lv 1 1 pt. 8,404
  9. Avatar for mrc.lcc 149. mrc.lcc Lv 1 1 pt. 8,378
  10. Avatar for cliptart 150. cliptart Lv 1 1 pt. 8,373

Comments