Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 9,656
  2. Avatar for :) 12. :) 1 pt. 9,468
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,278
  4. Avatar for Deleted group 14. Deleted group pts. 9,153
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,127
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 9,036
  7. Avatar for Window Group 17. Window Group 1 pt. 8,310

  1. Avatar for TastyMunchies 161. TastyMunchies Lv 1 1 pt. 8,306
  2. Avatar for Jdigs 162. Jdigs Lv 1 1 pt. 8,306
  3. Avatar for weaverka 163. weaverka Lv 1 1 pt. 8,306
  4. Avatar for Leo33 164. Leo33 Lv 1 1 pt. 8,306
  5. Avatar for feand 165. feand Lv 1 1 pt. 8,306
  6. Avatar for BenedictCarandang 166. BenedictCarandang Lv 1 1 pt. 8,306

Comments