Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for xkcd 11. xkcd 1 pt. 9,656
  2. Avatar for :) 12. :) 1 pt. 9,468
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,278
  4. Avatar for Deleted group 14. Deleted group pts. 9,153
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 9,127
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 9,036
  7. Avatar for Window Group 17. Window Group 1 pt. 8,310

  1. Avatar for stomjoh 41. stomjoh Lv 1 25 pts. 9,820
  2. Avatar for guineapig 42. guineapig Lv 1 24 pts. 9,811
  3. Avatar for jobo0502 43. jobo0502 Lv 1 24 pts. 9,806
  4. Avatar for carsonfb 44. carsonfb Lv 1 23 pts. 9,792
  5. Avatar for Mark- 45. Mark- Lv 1 22 pts. 9,790
  6. Avatar for cobaltteal 46. cobaltteal Lv 1 21 pts. 9,784
  7. Avatar for diamonddays 47. diamonddays Lv 1 20 pts. 9,782
  8. Avatar for tarimo 48. tarimo Lv 1 19 pts. 9,780
  9. Avatar for DoctorSockrates 49. DoctorSockrates Lv 1 18 pts. 9,780
  10. Avatar for manu8170 50. manu8170 Lv 1 18 pts. 9,779

Comments