Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,992
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,971
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,941
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,938
  5. Avatar for Go Science 5. Go Science 24 pts. 9,926
  6. Avatar for Contenders 6. Contenders 16 pts. 9,923
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,923
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,893
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 9,880
  10. Avatar for Natural Abilities 10. Natural Abilities 2 pts. 9,714

  1. Avatar for joremen 31. joremen Lv 1 37 pts. 9,857
  2. Avatar for ZeroLeak7 32. ZeroLeak7 Lv 1 36 pts. 9,855
  3. Avatar for caglar 33. caglar Lv 1 35 pts. 9,843
  4. Avatar for altejoh 34. altejoh Lv 1 33 pts. 9,843
  5. Avatar for weitzen 35. weitzen Lv 1 32 pts. 9,843
  6. Avatar for georg137 36. georg137 Lv 1 31 pts. 9,839
  7. Avatar for jausmh 37. jausmh Lv 1 30 pts. 9,839
  8. Avatar for Museka 38. Museka Lv 1 29 pts. 9,828
  9. Avatar for Blipperman 39. Blipperman Lv 1 28 pts. 9,827
  10. Avatar for MicElephant 40. MicElephant Lv 1 26 pts. 9,820

Comments