Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,992
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,971
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,941
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,938
  5. Avatar for Go Science 5. Go Science 24 pts. 9,926
  6. Avatar for Contenders 6. Contenders 16 pts. 9,923
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,923
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,893
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 9,880
  10. Avatar for Natural Abilities 10. Natural Abilities 2 pts. 9,714

  1. Avatar for stomjoh 41. stomjoh Lv 1 25 pts. 9,820
  2. Avatar for guineapig 42. guineapig Lv 1 24 pts. 9,811
  3. Avatar for jobo0502 43. jobo0502 Lv 1 24 pts. 9,806
  4. Avatar for carsonfb 44. carsonfb Lv 1 23 pts. 9,792
  5. Avatar for Mark- 45. Mark- Lv 1 22 pts. 9,790
  6. Avatar for cobaltteal 46. cobaltteal Lv 1 21 pts. 9,784
  7. Avatar for diamonddays 47. diamonddays Lv 1 20 pts. 9,782
  8. Avatar for tarimo 48. tarimo Lv 1 19 pts. 9,780
  9. Avatar for DoctorSockrates 49. DoctorSockrates Lv 1 18 pts. 9,780
  10. Avatar for manu8170 50. manu8170 Lv 1 18 pts. 9,779

Comments