Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since over 8 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,992
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,971
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,941
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,938
  5. Avatar for Go Science 5. Go Science 24 pts. 9,926
  6. Avatar for Contenders 6. Contenders 16 pts. 9,923
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,923
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 9,893
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 9,880
  10. Avatar for Natural Abilities 10. Natural Abilities 2 pts. 9,714

  1. Avatar for ppp6 61. ppp6 Lv 1 11 pts. 9,730
  2. Avatar for bcre8tvv 62. bcre8tvv Lv 1 10 pts. 9,724
  3. Avatar for Soggy Doglog 63. Soggy Doglog Lv 1 10 pts. 9,723
  4. Avatar for hansvandenhof 64. hansvandenhof Lv 1 10 pts. 9,718
  5. Avatar for Mr_Jolty 65. Mr_Jolty Lv 1 9 pts. 9,714
  6. Avatar for anthion 66. anthion Lv 1 9 pts. 9,712
  7. Avatar for Mohambone 67. Mohambone Lv 1 8 pts. 9,712
  8. Avatar for Idiotboy 68. Idiotboy Lv 1 8 pts. 9,710
  9. Avatar for Deleted player 69. Deleted player pts. 9,703
  10. Avatar for Festering Wounds 70. Festering Wounds Lv 1 7 pts. 9,698

Comments