Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Pilot

Summary

Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 8,244
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,192
  3. Avatar for Biochem-AD17 13. Biochem-AD17 1 pt. 8,176
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,999
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,929
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,809
  7. Avatar for GENE 433 17. GENE 433 1 pt. 7,648
  8. Avatar for D001x Med Chem MOOC 18. D001x Med Chem MOOC 1 pt. 7,631
  9. Avatar for Alpha Rays 19. Alpha Rays 1 pt. 6,640
  1. Avatar for Altercomp 21. Altercomp Lv 1 45 pts. 8,543
  2. Avatar for Anfinsen_slept_here 22. Anfinsen_slept_here Lv 1 43 pts. 8,539
  3. Avatar for thewholeblahthing 23. thewholeblahthing Lv 1 41 pts. 8,510
  4. Avatar for Glen B 24. Glen B Lv 1 39 pts. 8,494
  5. Avatar for Deleted player 25. Deleted player pts. 8,466
  6. Avatar for Xirxarc 26. Xirxarc Lv 1 36 pts. 8,461
  7. Avatar for isaksson 27. isaksson Lv 1 34 pts. 8,437
  8. Avatar for pfirth 28. pfirth Lv 1 33 pts. 8,423
  9. Avatar for mimi 29. mimi Lv 1 31 pts. 8,419
  10. Avatar for retiredmichael 30. retiredmichael Lv 1 30 pts. 8,414

Comments