Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Pilot

Summary

Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,646
  2. Avatar for Contenders 2. Contenders 76 pts. 8,642
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 8,619
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 8,595
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,594
  6. Avatar for Beta Folders 6. Beta Folders 20 pts. 8,582
  7. Avatar for freefolder 7. freefolder 14 pts. 8,543
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 8,336
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 8,328
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 4 pts. 8,255
  1. Avatar for Altercomp 21. Altercomp Lv 1 45 pts. 8,543
  2. Avatar for Anfinsen_slept_here 22. Anfinsen_slept_here Lv 1 43 pts. 8,539
  3. Avatar for thewholeblahthing 23. thewholeblahthing Lv 1 41 pts. 8,510
  4. Avatar for Glen B 24. Glen B Lv 1 39 pts. 8,494
  5. Avatar for Deleted player 25. Deleted player pts. 8,466
  6. Avatar for Xirxarc 26. Xirxarc Lv 1 36 pts. 8,461
  7. Avatar for isaksson 27. isaksson Lv 1 34 pts. 8,437
  8. Avatar for pfirth 28. pfirth Lv 1 33 pts. 8,423
  9. Avatar for mimi 29. mimi Lv 1 31 pts. 8,419
  10. Avatar for retiredmichael 30. retiredmichael Lv 1 30 pts. 8,414

Comments