Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Pilot

Summary

Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 2 pts. 8,244
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 8,192
  3. Avatar for Biochem-AD17 13. Biochem-AD17 1 pt. 8,176
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,999
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 7,929
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,809
  7. Avatar for GENE 433 17. GENE 433 1 pt. 7,648
  8. Avatar for D001x Med Chem MOOC 18. D001x Med Chem MOOC 1 pt. 7,631
  9. Avatar for Alpha Rays 19. Alpha Rays 1 pt. 6,640
  1. Avatar for stomjoh 71. stomjoh Lv 1 3 pts. 8,098
  2. Avatar for hada 72. hada Lv 1 3 pts. 8,092
  3. Avatar for Satina 73. Satina Lv 1 3 pts. 8,091
  4. Avatar for Deleted player 74. Deleted player pts. 8,087
  5. Avatar for christioanchauvin 75. christioanchauvin Lv 1 2 pts. 8,085
  6. Avatar for cobaltteal 76. cobaltteal Lv 1 2 pts. 8,079
  7. Avatar for nicobul 77. nicobul Lv 1 2 pts. 8,038
  8. Avatar for Arne Heessels 78. Arne Heessels Lv 1 2 pts. 8,035
  9. Avatar for rinze 79. rinze Lv 1 2 pts. 8,035
  10. Avatar for dpmattingly 80. dpmattingly Lv 1 2 pts. 8,009

Comments