Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Pilot

Summary

Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,646
  2. Avatar for Contenders 2. Contenders 76 pts. 8,642
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 8,619
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 8,595
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,594
  6. Avatar for Beta Folders 6. Beta Folders 20 pts. 8,582
  7. Avatar for freefolder 7. freefolder 14 pts. 8,543
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 8,336
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 8,328
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 4 pts. 8,255
  1. Avatar for stomjoh 71. stomjoh Lv 1 3 pts. 8,098
  2. Avatar for hada 72. hada Lv 1 3 pts. 8,092
  3. Avatar for Satina 73. Satina Lv 1 3 pts. 8,091
  4. Avatar for Deleted player 74. Deleted player pts. 8,087
  5. Avatar for christioanchauvin 75. christioanchauvin Lv 1 2 pts. 8,085
  6. Avatar for cobaltteal 76. cobaltteal Lv 1 2 pts. 8,079
  7. Avatar for nicobul 77. nicobul Lv 1 2 pts. 8,038
  8. Avatar for Arne Heessels 78. Arne Heessels Lv 1 2 pts. 8,035
  9. Avatar for rinze 79. rinze Lv 1 2 pts. 8,035
  10. Avatar for dpmattingly 80. dpmattingly Lv 1 2 pts. 8,009

Comments