Placeholder image of a protein
Icon representing a puzzle

1442: Sketchbook Puzzle - Revisiting Puzzle 136

Closed since over 8 years ago

Intermediate Intermediate Pilot Pilot

Summary


Created
October 20, 2017
Expires
Max points
100
Description

This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!



Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Go Science 100 pts. 8,646
  2. Avatar for Contenders 2. Contenders 76 pts. 8,642
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 8,619
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 8,595
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,594
  6. Avatar for Beta Folders 6. Beta Folders 20 pts. 8,582
  7. Avatar for freefolder 7. freefolder 14 pts. 8,543
  8. Avatar for Marvin's bunch 8. Marvin's bunch 9 pts. 8,336
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 6 pts. 8,328

  1. Avatar for dcrwheeler 61. dcrwheeler Lv 1 5 pts. 8,148
  2. Avatar for eusair 62. eusair Lv 1 5 pts. 8,146
  3. Avatar for benrh 63. benrh Lv 1 5 pts. 8,143
  4. Avatar for drjr 64. drjr Lv 1 5 pts. 8,137
  5. Avatar for jaro-18 65. jaro-18 Lv 1 4 pts. 8,129
  6. Avatar for TastyMunchies 66. TastyMunchies Lv 1 4 pts. 8,121
  7. Avatar for TheStaticSloth 67. TheStaticSloth Lv 1 4 pts. 8,113
  8. Avatar for alwen 68. alwen Lv 1 4 pts. 8,113
  9. Avatar for Alistair69 69. Alistair69 Lv 1 3 pts. 8,108
  10. Avatar for bcre8tvv 70. bcre8tvv Lv 1 3 pts. 8,098

Comments