1442: Sketchbook Puzzle - Revisiting Puzzle 136
Closed since over 8 years ago
Intermediate Intermediate Pilot PilotSummary
- Created
- October 20, 2017
- Expires
- Max points
- 100
This small protein interferes with cellular adhesion and, consequently, clotting mechanisms. In this experimental puzzle you will have 250 moves at your disposal. Once you use them up, you can reset and try something else!
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT