Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 9,237
  2. Avatar for freefolder 12. freefolder 2 pts. 9,157
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,729
  4. Avatar for GENE 433 14. GENE 433 1 pt. 8,728
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,626
  6. Avatar for xkcd 16. xkcd 1 pt. 8,619
  7. Avatar for Richard Dawkins Foundation 17. Richard Dawkins Foundation 1 pt. 8,459
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,839
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 7,097
  10. Avatar for EricHamber 20. EricHamber 1 pt. 6,211
  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 37 pts. 9,531
  2. Avatar for crpainter 32. crpainter Lv 1 36 pts. 9,521
  3. Avatar for guineapig 33. guineapig Lv 1 35 pts. 9,514
  4. Avatar for katling 34. katling Lv 1 34 pts. 9,513
  5. Avatar for diamonddays 35. diamonddays Lv 1 32 pts. 9,509
  6. Avatar for anthion 36. anthion Lv 1 31 pts. 9,506
  7. Avatar for johnmitch 37. johnmitch Lv 1 30 pts. 9,474
  8. Avatar for Bobnine 38. Bobnine Lv 1 29 pts. 9,463
  9. Avatar for YGK 39. YGK Lv 1 28 pts. 9,460
  10. Avatar for gurch 40. gurch Lv 1 27 pts. 9,440

Comments

Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!